Carlito syrichta (Philippine tarsier): 103250130 Help Entry 103250130         CDS       T07836                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01521   EGFR tyrosine kinase inhibitor resistance csyr01522   Endocrine resistance csyr04010   MAPK signaling pathway csyr04012   ErbB signaling pathway csyr04014   Ras signaling pathway csyr04015   Rap1 signaling pathway csyr04062   Chemokine signaling pathway csyr04068   FoxO signaling pathway csyr04071   Sphingolipid signaling pathway csyr04072   Phospholipase D signaling pathway csyr04137   Mitophagy - animal csyr04140   Autophagy - animal csyr04144   Endocytosis csyr04150   mTOR signaling pathway csyr04151   PI3K-Akt signaling pathway csyr04210   Apoptosis csyr04211   Longevity regulating pathway csyr04213   Longevity regulating pathway - multiple species csyr04218   Cellular senescence csyr04360   Axon guidance csyr04370   VEGF signaling pathway csyr04371   Apelin signaling pathway csyr04510   Focal adhesion csyr04540   Gap junction csyr04550   Signaling pathways regulating pluripotency of stem cells csyr04625   C-type lectin receptor signaling pathway csyr04630   JAK-STAT signaling pathway csyr04650   Natural killer cell mediated cytotoxicity csyr04660   T cell receptor signaling pathway csyr04662   B cell receptor signaling pathway csyr04664   Fc epsilon RI signaling pathway csyr04714   Thermogenesis csyr04720   Long-term potentiation csyr04722   Neurotrophin signaling pathway csyr04725   Cholinergic synapse csyr04726   Serotonergic synapse csyr04730   Long-term depression csyr04810   Regulation of actin cytoskeleton csyr04910   Insulin signaling pathway csyr04912   GnRH signaling pathway csyr04915   Estrogen signaling pathway csyr04916   Melanogenesis csyr04917   Prolactin signaling pathway csyr04919   Thyroid hormone signaling pathway csyr04921   Oxytocin signaling pathway csyr04926   Relaxin signaling pathway csyr04929   GnRH secretion csyr04933   AGE-RAGE signaling pathway in diabetic complications csyr04935   Growth hormone synthesis, secretion and action csyr05010   Alzheimer disease csyr05022   Pathways of neurodegeneration - multiple diseases csyr05034   Alcoholism csyr05132   Salmonella infection csyr05160   Hepatitis C csyr05161   Hepatitis B csyr05163   Human cytomegalovirus infection csyr05165   Human papillomavirus infection csyr05166   Human T-cell leukemia virus 1 infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05170   Human immunodeficiency virus 1 infection csyr05200   Pathways in cancer csyr05203   Viral carcinogenesis csyr05205   Proteoglycans in cancer csyr05206   MicroRNAs in cancer csyr05207   Chemical carcinogenesis - receptor activation csyr05208   Chemical carcinogenesis - reactive oxygen species csyr05210   Colorectal cancer csyr05211   Renal cell carcinoma csyr05213   Endometrial cancer csyr05214   Glioma csyr05215   Prostate cancer csyr05216   Thyroid cancer csyr05218   Melanoma csyr05219   Bladder cancer csyr05220   Chronic myeloid leukemia csyr05221   Acute myeloid leukemia csyr05223   Non-small cell lung cancer csyr05224   Breast cancer csyr05225   Hepatocellular carcinoma csyr05226   Gastric cancer csyr05230   Central carbon metabolism in cancer csyr05231   Choline metabolism in cancer csyr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csyr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103250130 (HRAS)    04012 ErbB signaling pathway     103250130 (HRAS)    04014 Ras signaling pathway     103250130 (HRAS)    04015 Rap1 signaling pathway     103250130 (HRAS)    04370 VEGF signaling pathway     103250130 (HRAS)    04371 Apelin signaling pathway     103250130 (HRAS)    04630 JAK-STAT signaling pathway     103250130 (HRAS)    04068 FoxO signaling pathway     103250130 (HRAS)    04072 Phospholipase D signaling pathway     103250130 (HRAS)    04071 Sphingolipid signaling pathway     103250130 (HRAS)    04151 PI3K-Akt signaling pathway     103250130 (HRAS)    04150 mTOR signaling pathway     103250130 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103250130 (HRAS)    04140 Autophagy - animal     103250130 (HRAS)    04137 Mitophagy - animal     103250130 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103250130 (HRAS)    04218 Cellular senescence     103250130 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103250130 (HRAS)    04540 Gap junction     103250130 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103250130 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103250130 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103250130 (HRAS)    04650 Natural killer cell mediated cytotoxicity     103250130 (HRAS)    04660 T cell receptor signaling pathway     103250130 (HRAS)    04662 B cell receptor signaling pathway     103250130 (HRAS)    04664 Fc epsilon RI signaling pathway     103250130 (HRAS)    04062 Chemokine signaling pathway     103250130 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103250130 (HRAS)    04929 GnRH secretion     103250130 (HRAS)    04912 GnRH signaling pathway     103250130 (HRAS)    04915 Estrogen signaling pathway     103250130 (HRAS)    04917 Prolactin signaling pathway     103250130 (HRAS)    04921 Oxytocin signaling pathway     103250130 (HRAS)    04926 Relaxin signaling pathway     103250130 (HRAS)    04935 Growth hormone synthesis, secretion and action     103250130 (HRAS)    04919 Thyroid hormone signaling pathway     103250130 (HRAS)    04916 Melanogenesis     103250130 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     103250130 (HRAS)    04726 Serotonergic synapse     103250130 (HRAS)    04720 Long-term potentiation     103250130 (HRAS)    04730 Long-term depression     103250130 (HRAS)    04722 Neurotrophin signaling pathway     103250130 (HRAS)   09158 Development and regeneration    04360 Axon guidance     103250130 (HRAS)   09149 Aging    04211 Longevity regulating pathway     103250130 (HRAS)    04213 Longevity regulating pathway - multiple species     103250130 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     103250130 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103250130 (HRAS)    05206 MicroRNAs in cancer     103250130 (HRAS)    05205 Proteoglycans in cancer     103250130 (HRAS)    05207 Chemical carcinogenesis - receptor activation     103250130 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     103250130 (HRAS)    05203 Viral carcinogenesis     103250130 (HRAS)    05230 Central carbon metabolism in cancer     103250130 (HRAS)    05231 Choline metabolism in cancer     103250130 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103250130 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103250130 (HRAS)    05225 Hepatocellular carcinoma     103250130 (HRAS)    05226 Gastric cancer     103250130 (HRAS)    05214 Glioma     103250130 (HRAS)    05216 Thyroid cancer     103250130 (HRAS)    05221 Acute myeloid leukemia     103250130 (HRAS)    05220 Chronic myeloid leukemia     103250130 (HRAS)    05218 Melanoma     103250130 (HRAS)    05211 Renal cell carcinoma     103250130 (HRAS)    05219 Bladder cancer     103250130 (HRAS)    05215 Prostate cancer     103250130 (HRAS)    05213 Endometrial cancer     103250130 (HRAS)    05224 Breast cancer     103250130 (HRAS)    05223 Non-small cell lung cancer     103250130 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103250130 (HRAS)    05170 Human immunodeficiency virus 1 infection     103250130 (HRAS)    05161 Hepatitis B     103250130 (HRAS)    05160 Hepatitis C     103250130 (HRAS)    05163 Human cytomegalovirus infection     103250130 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103250130 (HRAS)    05165 Human papillomavirus infection     103250130 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     103250130 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103250130 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     103250130 (HRAS)   09165 Substance dependence    05034 Alcoholism     103250130 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103250130 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103250130 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103250130 (HRAS)    01522 Endocrine resistance     103250130 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csyr04131]     103250130 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103250130 (HRAS)    04031 GTP-binding proteins [BR:csyr04031]     103250130 (HRAS) Membrane trafficking [BR:csyr04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103250130 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103250130 (HRAS) Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103250130 (HRAS)   Exosomal proteins of colorectal cancer cells    103250130 (HRAS) GTP-binding proteins [BR:csyr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103250130 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Motif Other DBs NCBI-GeneID:  103250130 NCBI-ProteinID:  XP_008046910 Ensembl:  ENSTSYG00000003745 UniProt:  A0A1U7SN00 LinkDB All DBs Position Unknown AA seq 340 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGFGSSSGTLWDPPGPMGPSGPSRRRG GRLLHAGARDPAAQAAEAEPAGRERPGLHELQVRALLTQVRGAGRRAPGPRAGASALLPA PGPTGPLACGQRRPLCPQRRPRIRGAGRSRRHRRKEGGGREGRKEGRGRRSPATQGRWTE AAADPPGTLCTDCHELSPTPPEPQPSAPLPALWGPLSGAG NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagcttgtggtggtgggcgctggtggcgtggggaagagcgccctgacc atccagttgatccagaaccactttgtggatgagtacgaccccaccatcgaggactcgtac cgaaagcaggtggtcattgatggggagacctgcctgctagacatcctggacacggcaggc caggaggagtacagcgccatgcgggaccagtatatgcgcaccggggagggcttcctctgc gtgtttgccatcaacaacaccaagtcttttgaggacatccatcagtacagagagcagatc aagcgggtgaaggactcagacgacgtgcccatggtgctggtggggaacaagtgtgacttg gctgcgcgcaccgtggaatcccggcaggctcaggacctggcccgcagctacggcatcccc tacatcgagacgtcggccaagacgcggcagggcagccgctctggctttggctccagctcc gggaccctctgggaccccccgggacccatgggacccagcggcccctcgcgccggcgtgga ggacgccttctacacgctggtgcgcgagatccggcagcacaagctgcggaagctgaaccc gccggacgagagcggcccgggctgcatgagctgcaagtgcgtgctctcctgacccaggtg aggggcgccggcaggcgggctcccggcccgcgagctggcgcgtccgctctgctaccggct cccggccccactggacccctggcctgcggtcagcggcgtcctttgtgcccccagcgcagg cctaggatccgaggcgccggacgcagcaggaggcacagacggaaggaaggaggagggagg gaaggaaggaaggaaggaaggggccgccggagcccggccacccagggacggtggacagag gcggctgcagaccctccagggacgctttgcacggactgtcatgaactgtccccaacgcca ccggaaccccagccctcggctcccctcccagccctctgggggcccctgtcgggcgcaggt tga

DBGET integrated database retrieval system