Carlito syrichta (Philippine tarsier): 103253163 Help Entry 103253163         CDS       T07836                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     103253163  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csyr03019]     103253163    03029 Mitochondrial biogenesis [BR:csyr03029]     103253163 Messenger RNA biogenesis [BR:csyr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103253163 Mitochondrial biogenesis [BR:csyr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     103253163 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  103253163 NCBI-ProteinID:  XP_008049800 UniProt:  A0A1U7SWC4 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MDPNCSCTIGGSCACPGSCKFKECKCTSCKKSGCRSCCPVGCAKCAQGCVCKEASDKCSC CA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcaccattggtggctcctgcgcctgccctggctcctgcaag ttcaaagagtgcaaatgcacatcctgcaagaagagtggctgccgctcctgctgccccgtg ggctgtgccaagtgtgcccagggctgtgtctgcaaagaggcctcggacaagtgcagctgc tgtgcctga

DBGET integrated database retrieval system