Carlito syrichta (Philippine tarsier): 103253566 Help Entry 103253566         CDS       T07836                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism csyr  Carlito syrichta (Philippine tarsier) Brite KEGG Orthology (KO) [BR:csyr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:csyr03041]     103253566   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103253566 Spliceosome [BR:csyr03041]  Complex B   Other components    Complex B specific factors     103253566 Cytokines and neuropeptides [BR:csyr04052]  Neuropeptides   Unclassified    103253566 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  103253566 NCBI-ProteinID:  XP_008050034 UniProt:  A0A1U7SQB7 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MTEVVCNGHLGKRVCVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKGYRIFKNHVSLGDC EIHNSMNLELYYQQIPFFCHLTPHTV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccgaggttgtctgcaacggccatctagggaaaagggtctgtgttaaatgcaacacc gatgacaccatcggggaccttaagaagctaattgcagcccagactggcactcgttggaac aagattgtcctgaagaaggggtacaggatttttaagaaccacgtgtctctgggagactgt gaaatccacaatagcatgaacctggaactttattatcagcagattccttttttctgccat ctcaccccccatactgtatag

DBGET integrated database retrieval system