Carlito syrichta (Philippine tarsier): 103253660 Help Entry 103253660         CDS       T07836                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04014   Ras signaling pathway csyr04015   Rap1 signaling pathway csyr04022   cGMP-PKG signaling pathway csyr04024   cAMP signaling pathway csyr04062   Chemokine signaling pathway csyr04071   Sphingolipid signaling pathway csyr04072   Phospholipase D signaling pathway csyr04081   Hormone signaling csyr04144   Endocytosis csyr04150   mTOR signaling pathway csyr04270   Vascular smooth muscle contraction csyr04310   Wnt signaling pathway csyr04350   TGF-beta signaling pathway csyr04360   Axon guidance csyr04510   Focal adhesion csyr04517   IgSF CAM signaling csyr04519   Cadherin signaling csyr04520   Adherens junction csyr04530   Tight junction csyr04611   Platelet activation csyr04621   NOD-like receptor signaling pathway csyr04625   C-type lectin receptor signaling pathway csyr04660   T cell receptor signaling pathway csyr04670   Leukocyte transendothelial migration csyr04722   Neurotrophin signaling pathway csyr04810   Regulation of actin cytoskeleton csyr04921   Oxytocin signaling pathway csyr04928   Parathyroid hormone synthesis, secretion and action csyr04972   Pancreatic secretion csyr05100   Bacterial invasion of epithelial cells csyr05132   Salmonella infection csyr05133   Pertussis csyr05135   Yersinia infection csyr05152   Tuberculosis csyr05163   Human cytomegalovirus infection csyr05200   Pathways in cancer csyr05203   Viral carcinogenesis csyr05205   Proteoglycans in cancer csyr05206   MicroRNAs in cancer csyr05210   Colorectal cancer csyr05417   Lipid and atherosclerosis csyr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103253660    04015 Rap1 signaling pathway     103253660    04310 Wnt signaling pathway     103253660    04350 TGF-beta signaling pathway     103253660    04072 Phospholipase D signaling pathway     103253660    04071 Sphingolipid signaling pathway     103253660    04024 cAMP signaling pathway     103253660    04022 cGMP-PKG signaling pathway     103253660    04150 mTOR signaling pathway     103253660   09133 Signaling molecules and interaction    04081 Hormone signaling     103253660    04517 IgSF CAM signaling     103253660    04519 Cadherin signaling     103253660  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103253660   09144 Cellular community - eukaryotes    04510 Focal adhesion     103253660    04520 Adherens junction     103253660    04530 Tight junction     103253660   09142 Cell motility    04810 Regulation of actin cytoskeleton     103253660  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103253660    04621 NOD-like receptor signaling pathway     103253660    04625 C-type lectin receptor signaling pathway     103253660    04660 T cell receptor signaling pathway     103253660    04670 Leukocyte transendothelial migration     103253660    04062 Chemokine signaling pathway     103253660   09152 Endocrine system    04921 Oxytocin signaling pathway     103253660    04928 Parathyroid hormone synthesis, secretion and action     103253660   09153 Circulatory system    04270 Vascular smooth muscle contraction     103253660   09154 Digestive system    04972 Pancreatic secretion     103253660   09156 Nervous system    04722 Neurotrophin signaling pathway     103253660   09158 Development and regeneration    04360 Axon guidance     103253660  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103253660    05206 MicroRNAs in cancer     103253660    05205 Proteoglycans in cancer     103253660    05203 Viral carcinogenesis     103253660   09162 Cancer: specific types    05210 Colorectal cancer     103253660   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103253660   09171 Infectious disease: bacterial    05132 Salmonella infection     103253660    05135 Yersinia infection     103253660    05133 Pertussis     103253660    05152 Tuberculosis     103253660    05100 Bacterial invasion of epithelial cells     103253660   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103253660    05418 Fluid shear stress and atherosclerosis     103253660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csyr04131]     103253660   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103253660    04031 GTP-binding proteins [BR:csyr04031]     103253660 Membrane trafficking [BR:csyr04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103253660 Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103253660   Exosomal proteins of other body fluids (saliva and urine)    103253660   Exosomal proteins of colorectal cancer cells    103253660   Exosomal proteins of bladder cancer cells    103253660 GTP-binding proteins [BR:csyr04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103253660 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc AAA_RNF213_3 RsgA_GTPase Motif Other DBs NCBI-GeneID:  103253660 NCBI-ProteinID:  XP_008050104 UniProt:  A0A1U7SQI2 LinkDB All DBs Position Unknown AA seq 164 aa AA seqDB search MAAIPKKVVIVGNGACGKTRLLMFFSKDQFPEVFMLEVFMLKVFENYVEDYDHLRPLSYP DTDVLLMCFSSNSPDSLENIAERWTPEVKHFCPNAPVILVGNKKDLCNDEHTKRELAKMK QEPVKLEEGRDMASGIGALGYVECWAKTKDGVREVFEMAARTAL NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atggctgctatcccgaagaaagtggtgattgtcggcaatggagcctgtggcaagacacgc ttgctcatgttcttcagcaaggaccagttcccagaggtgtttatgcttgaggtgtttatg cttaaggtgtttgagaactatgtggaagattatgatcacctgaggcctctctcctaccca gacaccgatgttctattgatgtgtttctccagcaatagtcccgatagtttagaaaacatc gccgaaagatggactccagaagtcaagcatttctgtcccaatgcacccgtcatcctggtt gggaataagaaggatctttgcaatgatgaacacacaaagcgggagctagccaagatgaag caggaaccggtaaaacttgaagaaggcagagacatggcaagtgggattggtgctttaggg tatgtggagtgttgggcaaagaccaaagatggagtgagggaggtttttgaaatggctgcg agaactgctttgtaa

DBGET integrated database retrieval system