Carlito syrichta (Philippine tarsier): 103254477 Help Entry 103254477         CDS       T07836                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04613   Neutrophil extracellular trap formation csyr05034   Alcoholism csyr05202   Transcriptional misregulation in cancer csyr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103254477  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103254477   09163 Immune disease    05322 Systemic lupus erythematosus     103254477   09165 Substance dependence    05034 Alcoholism     103254477  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csyr03036]     103254477   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103254477 Chromosome and associated proteins [BR:csyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103254477 Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103254477 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S THSD1_D2 PAF Motif Other DBs NCBI-GeneID:  103254477 NCBI-ProteinID:  XP_021565448 UniProt:  A0A3Q0DUL1 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MAGTKQTARKSTGGKAPRRQLATKATRKSAPSTGGVKKPHRYRPGTGARREMRRYQESTE LLVGQLPFQPLVREIAQGFTTDLRFPSAATGALQEASEAYRVGLFEDTDLCALHAKRVTI MPKDIQLARRIRGKRA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctggtacaaagcagacggcccgcaaatcgaccggtggtaaagcgcccaggaggcaa ctggctacaaaagccactcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtaccggggcacgccgtgaaatgagacgttatcaggagtccacggaa cttctggttggccaacttcctttccagcctctggtgcgagaaattgctcagggcttcaca acagatctgcgcttcccgagcgcagctactggtgctttgcaggaggcaagtgaggcctat cgggttggcctttttgaagacaccgacctgtgtgccctccatgccaaacgtgtaacaatt atgccgaaagacatccagctagcacgccgcatacgtggaaaacgtgcttaa

DBGET integrated database retrieval system