Carlito syrichta (Philippine tarsier): 103254887 Help Entry 103254887         CDS       T07836                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103254887 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103254887 (NPS) Cytokines and neuropeptides [BR:csyr04052]  Neuropeptides   GPCR binding    103254887 (NPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  103254887 NCBI-ProteinID:  XP_008051062 Ensembl:  ENSTSYG00000012238 UniProt:  A0A1U7TDM5 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MTGSLKVNLILVLSLSTMHVLWCYPVPSSKVPGKFDDFLFLMDNCLTRLDRDEGLAFLKP VLEKAFLKRSFRNGVGTGMKKTSSRRAKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactggttcactaaaagtcaaccttattttagttctgtcactgtctacaatgcatgta ttgtggtgttatccggttccatcttctaaggtgcctgggaaatttgatgactttcttttc ctgatggacaactgtctcaccagactggacagggacgagggactagcttttctaaagcca gttttggagaaggcatttttgaaaaggtcctttcgcaatggagttggcacggggatgaaa aaaacttcctctcgaagagcaaaatcctga

DBGET integrated database retrieval system