Carlito syrichta (Philippine tarsier): 103255431 Help Entry 103255431         CDS       T07836                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04010   MAPK signaling pathway csyr04020   Calcium signaling pathway csyr04022   cGMP-PKG signaling pathway csyr04114   Oocyte meiosis csyr04218   Cellular senescence csyr04310   Wnt signaling pathway csyr04360   Axon guidance csyr04370   VEGF signaling pathway csyr04380   Osteoclast differentiation csyr04625   C-type lectin receptor signaling pathway csyr04650   Natural killer cell mediated cytotoxicity csyr04658   Th1 and Th2 cell differentiation csyr04659   Th17 cell differentiation csyr04660   T cell receptor signaling pathway csyr04662   B cell receptor signaling pathway csyr04720   Long-term potentiation csyr04724   Glutamatergic synapse csyr04921   Oxytocin signaling pathway csyr04922   Glucagon signaling pathway csyr04924   Renin secretion csyr05010   Alzheimer disease csyr05014   Amyotrophic lateral sclerosis csyr05020   Prion disease csyr05022   Pathways of neurodegeneration - multiple diseases csyr05031   Amphetamine addiction csyr05152   Tuberculosis csyr05163   Human cytomegalovirus infection csyr05166   Human T-cell leukemia virus 1 infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05170   Human immunodeficiency virus 1 infection csyr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csyr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103255431 (PPP3R2)    04310 Wnt signaling pathway     103255431 (PPP3R2)    04370 VEGF signaling pathway     103255431 (PPP3R2)    04020 Calcium signaling pathway     103255431 (PPP3R2)    04022 cGMP-PKG signaling pathway     103255431 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103255431 (PPP3R2)    04218 Cellular senescence     103255431 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103255431 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     103255431 (PPP3R2)    04660 T cell receptor signaling pathway     103255431 (PPP3R2)    04658 Th1 and Th2 cell differentiation     103255431 (PPP3R2)    04659 Th17 cell differentiation     103255431 (PPP3R2)    04662 B cell receptor signaling pathway     103255431 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     103255431 (PPP3R2)    04921 Oxytocin signaling pathway     103255431 (PPP3R2)    04924 Renin secretion     103255431 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     103255431 (PPP3R2)    04720 Long-term potentiation     103255431 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     103255431 (PPP3R2)    04380 Osteoclast differentiation     103255431 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103255431 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103255431 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     103255431 (PPP3R2)    05163 Human cytomegalovirus infection     103255431 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     103255431 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     103255431 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     103255431 (PPP3R2)    05014 Amyotrophic lateral sclerosis     103255431 (PPP3R2)    05020 Prion disease     103255431 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     103255431 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     103255431 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103255431 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csyr01009]     103255431 (PPP3R2) Protein phosphatases and associated proteins [BR:csyr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103255431 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 Motif Other DBs NCBI-GeneID:  103255431 NCBI-ProteinID:  XP_008051565 UniProt:  A0A1U7T1B2 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEMCSHFDNDEIKRLSKRFKKLNVDRSGSLSVGEFMNLPGLRRNPLVRRVID IFDTDGDGEVDFKEFIRGASQFSVKGDKEEKLRFAFNIYDMDKDGYISNGELFQVLKMMV GDSIKDWQLQQLVDKTIIILDRDGDGKISFEEFSAVVGDLDIHKKMALCI NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgaggccagttacccggaggagatgtgctcccactttgacaatgacgaaatt aaaaggttgagtaagcggtttaagaagctgaacgtggacagatcaggctccctgagcgta ggagagttcatgaacctgccagggttgcggcggaaccccttggtgcggcgagtgatcgac atcttcgacaccgacggcgatggagaagtagacttcaaagaattcatcaggggggcctcc cagttcagcgtcaaaggcgacaaggaggagaagctgaggtttgccttcaacatctacgac atggataaagacggctacatttccaatggggagctcttccaggtgctgaagatgatggtg ggcgacagcataaaggactggcagctgcagcagctcgtcgacaaaaccatcatcatcctg gacagggacggtgacgggaagatatccttcgaggaattcagtgctgtggtcggagacctg gatatccacaagaagatggccctttgtatttga

DBGET integrated database retrieval system