Carlito syrichta (Philippine tarsier): 103256213 Help Entry 103256213         CDS       T07836                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     103256213  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csyr03019]     103256213    03029 Mitochondrial biogenesis [BR:csyr03029]     103256213 Messenger RNA biogenesis [BR:csyr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103256213 Mitochondrial biogenesis [BR:csyr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     103256213 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  103256213 NCBI-ProteinID:  XP_008052307 UniProt:  A0A1U7TH51 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCAAGDSCACAGSCKCKECKCPSCKKSCCSCCPVGCAKCAQGCVCKEASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccgctggtgactcctgtgcctgtgctggctcctgcaag tgcaaagagtgcaaatgcccatcctgcaagaagagctgctgttcctgctgccccgtgggc tgtgccaagtgtgcccagggctgtgtctgcaaagaggcctcggacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system