Carlito syrichta (Philippine tarsier): 103257041 Help Entry 103257041         CDS       T07836                                  Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04140   Autophagy - animal csyr05014   Amyotrophic lateral sclerosis csyr05022   Pathways of neurodegeneration - multiple diseases csyr05134   Legionellosis Brite KEGG Orthology (KO) [BR:csyr00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103257041  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     103257041   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103257041    05022 Pathways of neurodegeneration - multiple diseases     103257041  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csyr04131]     103257041   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103257041    04031 GTP-binding proteins [BR:csyr04031]     103257041 Membrane trafficking [BR:csyr04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     103257041  Autophagy   Other autophagy associated proteins     103257041 Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103257041   Exosomal proteins of other body fluids (saliva and urine)    103257041   Exosomal proteins of colorectal cancer cells    103257041 GTP-binding proteins [BR:csyr04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     103257041 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_16 LANC_like AAA_22 Septin AAA_29 AAA_5 CRAL_TRIO_2 Dioxygenase_N Motif Other DBs NCBI-GeneID:  103257041 NCBI-ProteinID:  XP_008052970 Ensembl:  ENSTSYG00000005996 UniProt:  A0A1U7T5A1 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search DYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA GQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDL TTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKS NVKIQSTPVKQSGGGCC NT seq 595 nt NT seq  +upstreamnt  +downstreamnt tgattatttattcaaattacttctcattggcgactctggggttggaaagtcttgccttct tcttaggtttgcagatgatacatatacagaaagctacatcagtacaattggcgtggattt caaaataagaactatagagttagacgggaaaacaatcaagcttcaaatatgggacacagc tggccaagaaagatttcgaacaatcacttccagttactacagaggagcccatggcatcat agttgtgtatgatgtgacagatcaggagtccttcaataatgttaaacagtggctgcagga aatagatcgttatgccagtgagaacgtcaacaaattgttggtagggaacaaatgtgatct gaccacaaagaaagtagtagattacacaacagcaaaggaatttgctgattcccttggaat tccatttttggaaaccagtgctaagaacgcaacaaatgtagaacagtctttcatgacgat ggcagctgagattaaaaaacgaatgggtcctggagcaacagctggtggtgcagagaagtc caatgttaaaattcagagcactccggtcaagcagtcaggtggaggttgctgctaa

DBGET integrated database retrieval system