Carlito syrichta (Philippine tarsier): 103257595 Help Entry 103257595         CDS       T07836                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04621   NOD-like receptor signaling pathway csyr05012   Parkinson disease csyr05132   Salmonella infection csyr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103257595  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103257595   09164 Neurodegenerative disease    05012 Parkinson disease     103257595   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103257595  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:csyr03110]     103257595 Chaperones and folding catalysts [BR:csyr03110]  Protein folding catalysts   Protein disulfide isomerase    103257595 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 OST3_OST6 Thioredoxin_2 AhpC-TSA NODP Motif Other DBs NCBI-GeneID:  103257595 NCBI-ProteinID:  XP_008053479 UniProt:  A0A1U7T069 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIETKAPFQDALEAAGDKLVVVDFSATWRGPCKTIKPFFHSLSEKYSSVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaaacagatcgaaaccaaggccccttttcaggatgccttggaagctgcaggtgat aaacttgttgtagttgacttctcagccacgtggcgtggaccttgcaaaacgatcaagcct ttctttcattccctctctgaaaagtattccagtgtggtgttccttgaagtggatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgtatgccaaccttccagtttttt aaaaagggacaaaaggtgggtgaattttctggagctaataaggaaaagcttgaagccacc attaatgaattactctaa

DBGET integrated database retrieval system