Carlito syrichta (Philippine tarsier): 103258093 Help Entry 103258093         CDS       T07836                                  Symbol AKT1S1 Name (RefSeq) proline-rich AKT1 substrate 1   KO K16184   proline-rich AKT1 substrate 1 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04140   Autophagy - animal csyr04142   Lysosome biogenesis csyr04150   mTOR signaling pathway csyr04152   AMPK signaling pathway csyr04156   Integrated stress response (ISR) signaling pathway csyr04211   Longevity regulating pathway csyr04213   Longevity regulating pathway - multiple species csyr04714   Thermogenesis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     103258093 (AKT1S1)    04150 mTOR signaling pathway     103258093 (AKT1S1)  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome biogenesis     103258093 (AKT1S1)    04140 Autophagy - animal     103258093 (AKT1S1)   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     103258093 (AKT1S1)  09150 Organismal Systems   09149 Aging    04211 Longevity regulating pathway     103258093 (AKT1S1)    04213 Longevity regulating pathway - multiple species     103258093 (AKT1S1)   09159 Environmental adaptation    04714 Thermogenesis     103258093 (AKT1S1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csyr04131]     103258093 (AKT1S1) Membrane trafficking [BR:csyr04131]  Autophagy   Other autophagy associated proteins    mTORC1 complex     103258093 (AKT1S1) SSDB OrthologParalogGFIT Motif Pfam:  PRAS Senescence_reg Motif Other DBs NCBI-GeneID:  103258093 NCBI-ProteinID:  XP_021566919 UniProt:  A0A3Q0DRL5 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSFEGGHGAGPAMLATGTPTGTFALAVDRVHGVGGLFVMDEDATLQDLPPFCESDPESTD DGSLSEETPTGPAAYAVPPASALPTQQYAKSLPVSVPVWAFKEKRTEARSSDEENGPAGI DQPLPILAALSAVASRAGERDLSGLPIGSVVVFRLATDFL NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtcttttgagggcggccacggcgccgggccggccatgctggctacgggcacacccacg gggacctttgccttggccgtggaccgtgtccacggggtcggggggctctttgtgatggat gaggacgccaccctccaagacctgccccccttctgcgagtcggaccccgagagcacagac gacggcagcctgagcgaggagacccccactggccccgcagcctacgcggtgcccccagcc tcggccctccccacacagcagtatgccaagtccctgcccgtgtccgtgccagtctgggcc ttcaaggagaagaggacagaggcgcggtcgtcggatgaggagaatgggccggccgggatc gaccagcctctgccaatcctcgccgccctttcggccgtggcctcccgcgccggggagcgg gatctgtccgggctcccgattgggtctgtcgtcgtcttccgcctagcgacagactttcta tga

DBGET integrated database retrieval system