Carlito syrichta (Philippine tarsier): 103259193 Help Entry 103259193         CDS       T07836                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism csyr  Carlito syrichta (Philippine tarsier) Brite KEGG Orthology (KO) [BR:csyr00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:csyr01002]     103259193 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103259193 (CSTB) Peptidases and inhibitors [BR:csyr01002]  Peptidase inhibitors   Family I25: cystatin family    103259193 (CSTB) Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103259193 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light DUF1444 AAA_lid_NAV1 Motif Other DBs NCBI-GeneID:  103259193 NCBI-ProteinID:  XP_008055050 Ensembl:  ENSTSYG00000026444 UniProt:  A0A1U7TB45 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MMCGAPTSTQPATDEIQHIADQVKSQLEKKENKTFPVFKAMSFKSQLVAGTNYFIKVHVG GDVYIHLRVFRSLPHENQALTLSDYQTNKAQHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgcccaccagcacacagcccgccacggacgagatccagcatattgct gaccaggtgaagtcccagcttgaaaagaaggaaaataagacgttccctgtctttaaggcg atgtccttcaagagccagttggtcgcgggaaccaactatttcatcaaggttcacgttggt ggtgatgtttacattcacctgagagtatttcgaagtctgcctcatgaaaaccaggccttg acattatctgactaccagaccaacaaagcccagcatgatgagctgagctatttctga

DBGET integrated database retrieval system