Carlito syrichta (Philippine tarsier): 103259256 Help Entry 103259256         CDS       T07836                                  Symbol IL13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04060   Cytokine-cytokine receptor interaction csyr04630   JAK-STAT signaling pathway csyr04657   IL-17 signaling pathway csyr04658   Th1 and Th2 cell differentiation csyr04664   Fc epsilon RI signaling pathway csyr05200   Pathways in cancer csyr05310   Asthma csyr05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103259256 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103259256 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     103259256 (IL13)    04657 IL-17 signaling pathway     103259256 (IL13)    04664 Fc epsilon RI signaling pathway     103259256 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103259256 (IL13)   09163 Immune disease    05310 Asthma     103259256 (IL13)    05321 Inflammatory bowel disease     103259256 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103259256 (IL13) Cytokines and neuropeptides [BR:csyr04052]  Cytokines   Interleukins    103259256 (IL13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  103259256 NCBI-ProteinID:  XP_008055119 Ensembl:  ENSTSYG00000001534 UniProt:  A0A1U7T4Z3 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MALWLTLVIALTCLGGLASPGPVPHFTALKELIEELVNITQNQKGAPLCNGSMVWSFNLT TDVYCAALESLINVSGCSAIQKTQRMLSGLCSRKVSAGQASSLHVQDTKIEVAQFIKDLL RHLRRLYHRGKFD NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggcgctctggttgaccctggtcattgctctcacctgccttggtggccttgcctcccca ggccccgtccctcactttacagccctcaaggagctcatcgaggagctggtcaacatcacc cagaaccagaagggggcacctctctgcaatggcagcatggtgtggagcttcaacctgaca actgatgtgtactgtgcagccctggaatccctgatcaacgtgtcgggttgcagtgccatc caaaagacccagaggatgctgagcggactctgctcacgcaaggtctcagctgggcaggct tccagcctccacgttcaagacaccaaaattgaagtggcccagttcataaaggacctgctc agacatttaagaagactttaccaccgtggaaagttcgactga

DBGET integrated database retrieval system