Carlito syrichta (Philippine tarsier): 103259373 Help Entry 103259373         CDS       T07836                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04613   Neutrophil extracellular trap formation csyr05034   Alcoholism csyr05203   Viral carcinogenesis csyr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103259373  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103259373   09163 Immune disease    05322 Systemic lupus erythematosus     103259373   09165 Substance dependence    05034 Alcoholism     103259373  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csyr03036]     103259373 Chromosome and associated proteins [BR:csyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103259373 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  103259373 NCBI-ProteinID:  XP_008055236 Ensembl:  ENSTSYG00000033976 UniProt:  A0A1U7TD77 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgagggaagggcggaaaaggcttaggcaaaggtggtgcgaagcgccaccgt aaagtcttgagagacaatatccagggcatcaccaagcctgcgattcggcgtcttgctcgg cgtggaggtgtaaagcggatctctggtctcatctacgaggaaacccgcggtgtgttaaag gtgtttctggagaacgtcatccgggacgcggtcacctacacagagcacgccaagcgcaag acagtcaccgccatggacgtggtgtacgcgctcaaacgccaggggcgcaccctgtacggc ttcgggggctag

DBGET integrated database retrieval system