Carlito syrichta (Philippine tarsier): 103259440 Help Entry 103259440         CDS       T07836                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01523   Antifolate resistance csyr04010   MAPK signaling pathway csyr04060   Cytokine-cytokine receptor interaction csyr04064   NF-kappa B signaling pathway csyr04217   Necroptosis csyr04380   Osteoclast differentiation csyr04620   Toll-like receptor signaling pathway csyr04621   NOD-like receptor signaling pathway csyr04623   Cytosolic DNA-sensing pathway csyr04625   C-type lectin receptor signaling pathway csyr04640   Hematopoietic cell lineage csyr04657   IL-17 signaling pathway csyr04659   Th17 cell differentiation csyr04668   TNF signaling pathway csyr04750   Inflammatory mediator regulation of TRP channels csyr04932   Non-alcoholic fatty liver disease csyr04933   AGE-RAGE signaling pathway in diabetic complications csyr04936   Alcoholic liver disease csyr04940   Type I diabetes mellitus csyr05010   Alzheimer disease csyr05020   Prion disease csyr05022   Pathways of neurodegeneration - multiple diseases csyr05132   Salmonella infection csyr05133   Pertussis csyr05134   Legionellosis csyr05135   Yersinia infection csyr05140   Leishmaniasis csyr05142   Chagas disease csyr05143   African trypanosomiasis csyr05144   Malaria csyr05146   Amoebiasis csyr05152   Tuberculosis csyr05162   Measles csyr05163   Human cytomegalovirus infection csyr05164   Influenza A csyr05168   Herpes simplex virus 1 infection csyr05171   Coronavirus disease - COVID-19 csyr05321   Inflammatory bowel disease csyr05323   Rheumatoid arthritis csyr05332   Graft-versus-host disease csyr05417   Lipid and atherosclerosis csyr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103259440 (IL1B)    04064 NF-kappa B signaling pathway     103259440 (IL1B)    04668 TNF signaling pathway     103259440 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103259440 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103259440 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103259440 (IL1B)    04620 Toll-like receptor signaling pathway     103259440 (IL1B)    04621 NOD-like receptor signaling pathway     103259440 (IL1B)    04623 Cytosolic DNA-sensing pathway     103259440 (IL1B)    04625 C-type lectin receptor signaling pathway     103259440 (IL1B)    04659 Th17 cell differentiation     103259440 (IL1B)    04657 IL-17 signaling pathway     103259440 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103259440 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     103259440 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     103259440 (IL1B)    05164 Influenza A     103259440 (IL1B)    05162 Measles     103259440 (IL1B)    05168 Herpes simplex virus 1 infection     103259440 (IL1B)    05163 Human cytomegalovirus infection     103259440 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     103259440 (IL1B)    05135 Yersinia infection     103259440 (IL1B)    05133 Pertussis     103259440 (IL1B)    05134 Legionellosis     103259440 (IL1B)    05152 Tuberculosis     103259440 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     103259440 (IL1B)    05144 Malaria     103259440 (IL1B)    05140 Leishmaniasis     103259440 (IL1B)    05142 Chagas disease     103259440 (IL1B)    05143 African trypanosomiasis     103259440 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     103259440 (IL1B)    05321 Inflammatory bowel disease     103259440 (IL1B)    05332 Graft-versus-host disease     103259440 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     103259440 (IL1B)    05020 Prion disease     103259440 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     103259440 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103259440 (IL1B)    05418 Fluid shear stress and atherosclerosis     103259440 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103259440 (IL1B)    04936 Alcoholic liver disease     103259440 (IL1B)    04932 Non-alcoholic fatty liver disease     103259440 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     103259440 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103259440 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103259440 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:csyr00536]     103259440 (IL1B) Cytokines and neuropeptides [BR:csyr04052]  Cytokines   Interleukins    103259440 (IL1B) Glycosaminoglycan binding proteins [BR:csyr00536]  Heparan sulfate / Heparin   Cytokines    103259440 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Inhibitor_I71 Motif Other DBs NCBI-GeneID:  103259440 NCBI-ProteinID:  XP_008055300 Ensembl:  ENSTSYG00000007934 UniProt:  A0A1U7TBU6 LinkDB All DBs Position Unknown AA seq 267 aa AA seqDB search MATVPEPASEMMDYYSSNEDDLFFEVDGPKQMKCSFQNLDVCPLDEGIHLQISHQHHNKS FRQIVSVIVAVEKLQKMLVPCPKAFQDNDLSALLSFIFEEEAIILDTWDDSFVCDAPVRM LNCTLQDVQQKCLVMSGPYELKALHLQGRELDQQVVFSMSYVQGEENSDKMPVALGLKEK NLYLSCVMKGEKPILQLESIDPKNYPKKKMEKRFVFNKIEIKDKVEFESAQFPNWYISTS QAENMPVFLGDTKGGQDITDFTMRFVS NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atggcaacagtacctgaacctgccagtgagatgatggattactacagcagcaatgaggat gacctgttctttgaagtcgatggccccaaacaaatgaagtgctccttccaaaacttggat gtctgccctctggatgagggcatccatctgcaaatctcccaccagcaccacaacaagagt ttcaggcagatcgtatctgtcatcgtggctgtggaaaagctgcagaagatgctagttccc tgcccaaaggccttccaggataatgacctgagtgctctcttgtccttcatctttgaagaa gaggctatcatcttggacacatgggatgactcttttgtgtgtgatgcacctgtgcgaatg ctgaactgtacacttcaggacgtacaacaaaagtgtctggtgatgtctggcccatatgag ctgaaagccctccatctccagggacgagaactggaccaacaagtggtgttctccatgagc tatgtgcaaggagaagaaaatagtgacaaaatgcccgtggccttgggcctcaaggaaaag aatctgtacctgtcctgcgtgatgaagggtgagaagcccatcctgcagctagagagtata gaccctaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagattgaa ataaaagacaaggtggaatttgagtctgcccaattccccaactggtacatcagcacctct caagcagaaaacatgcccgtcttcctgggagataccaaaggaggccaggatataactgac ttcaccatgcgattcgtgtcttaa

DBGET integrated database retrieval system