Carlito syrichta (Philippine tarsier): 103259657 Help Entry 103259657         CDS       T07836                                  Name (RefSeq) profilin-2   KO K05759   profilin Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04015   Rap1 signaling pathway csyr04810   Regulation of actin cytoskeleton csyr05014   Amyotrophic lateral sclerosis csyr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103259657  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103259657  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103259657   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103259657  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csyr04131]     103259657   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csyr04812]     103259657    04147 Exosome [BR:csyr04147]     103259657 Membrane trafficking [BR:csyr04131]  Others   Actin-binding proteins    Others     103259657 Cytoskeleton proteins [BR:csyr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103259657 Exosome [BR:csyr04147]  Exosomal proteins   Proteins found in most exosomes    103259657 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103259657 NCBI-ProteinID:  XP_021567620 UniProt:  A0A3Q0DZZ9 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRA LVIVMGKEGVHGGTLNKKAYELALYLRRYPNITIWSVSSLFFIGPILFAA NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgattgtaggaaaagaccgggaaggtttctttaccaacggtttgactcttggtgcaaag aagtgctcagtgatcagagatagtctatacgtcgatggtgactgcacaatggacatccgg acaaagagtcaaggtggggagccaacatacaatgttgctgtgggcagagctggtagagca ttggttatagtcatgggaaaggaaggtgtccacggaggcacacttaacaagaaagcatat gaactcgctttatacctgaggaggtatcccaacataaccatctggagtgtgtccagtttg ttcttcataggaccaattttatttgcagcttga

DBGET integrated database retrieval system