Carlito syrichta (Philippine tarsier): 103259954 Help Entry 103259954         CDS       T07836                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04613   Neutrophil extracellular trap formation csyr05034   Alcoholism csyr05203   Viral carcinogenesis csyr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103259954  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103259954   09163 Immune disease    05322 Systemic lupus erythematosus     103259954   09165 Substance dependence    05034 Alcoholism     103259954  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csyr03036]     103259954   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103259954 Chromosome and associated proteins [BR:csyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103259954 Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103259954 SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  103259954 NCBI-ProteinID:  XP_008055795 Ensembl:  ENSTSYG00000031577 UniProt:  A0A1U7TD85 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccagccaaatccgctcctgctccaaagaagggctccaaaaaggcggtcacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgtaaggagagctactcagtg tatgtgtacaaggtgttgaagcaggtccaccctgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggctgtcacc aaatacactagctccaagtaa

DBGET integrated database retrieval system