Carlito syrichta (Philippine tarsier): 103260233 Help Entry 103260233         CDS       T07836                                  Symbol RD3 Name (RefSeq) protein RD3   KO K25404   protein RD3 Organism csyr  Carlito syrichta (Philippine tarsier) Brite KEGG Orthology (KO) [BR:csyr00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:csyr03037]     103260233 (RD3) Cilium and associated proteins [BR:csyr03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    103260233 (RD3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RD3 MAP2_projctn DUF5917 Motif Other DBs NCBI-GeneID:  103260233 NCBI-ProteinID:  XP_008056070 UniProt:  A0A1U7TE05 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MVPRPPLPARFRQLVAQHEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTRQWSLRPRTG LAPFKTRARISPFASDIRTISEDVERDTLPPPRAWSMPEFRVPKAE NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggtcccacgccccccccttcccgccaggttccggcagctggtggcccagcacgagccc gaggtgcaggaggtgtcccagctcttccgctcggtgctgcaggaggtcctggagaggatg aagcaggaggaggaggcccacaaactgacgcgccagtggagcctgcggccccgcaccggc ctggcccccttcaagacccgcgcgcgcatctcccccttcgccagcgacatccggaccatc tccgaggacgtggagcgggacacgctgccgccgccccgggcctggagcatgcccgagttc cgcgtgcccaaagccgaatga

DBGET integrated database retrieval system