Carlito syrichta (Philippine tarsier): 103260907 Help Entry 103260907         CDS       T07836                                  Name (RefSeq) interferon alpha-5-like   KO K05414   interferon alpha Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04060   Cytokine-cytokine receptor interaction csyr04151   PI3K-Akt signaling pathway csyr04217   Necroptosis csyr04620   Toll-like receptor signaling pathway csyr04621   NOD-like receptor signaling pathway csyr04622   RIG-I-like receptor signaling pathway csyr04623   Cytosolic DNA-sensing pathway csyr04630   JAK-STAT signaling pathway csyr04650   Natural killer cell mediated cytotoxicity csyr04936   Alcoholic liver disease csyr05152   Tuberculosis csyr05160   Hepatitis C csyr05161   Hepatitis B csyr05162   Measles csyr05163   Human cytomegalovirus infection csyr05164   Influenza A csyr05165   Human papillomavirus infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05168   Herpes simplex virus 1 infection csyr05169   Epstein-Barr virus infection csyr05170   Human immunodeficiency virus 1 infection csyr05171   Coronavirus disease - COVID-19 csyr05200   Pathways in cancer csyr05320   Autoimmune thyroid disease csyr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103260907    04151 PI3K-Akt signaling pathway     103260907   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103260907  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103260907  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103260907    04621 NOD-like receptor signaling pathway     103260907    04622 RIG-I-like receptor signaling pathway     103260907    04623 Cytosolic DNA-sensing pathway     103260907    04650 Natural killer cell mediated cytotoxicity     103260907  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103260907   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103260907    05161 Hepatitis B     103260907    05160 Hepatitis C     103260907    05171 Coronavirus disease - COVID-19     103260907    05164 Influenza A     103260907    05162 Measles     103260907    05168 Herpes simplex virus 1 infection     103260907    05163 Human cytomegalovirus infection     103260907    05167 Kaposi sarcoma-associated herpesvirus infection     103260907    05169 Epstein-Barr virus infection     103260907    05165 Human papillomavirus infection     103260907   09171 Infectious disease: bacterial    05152 Tuberculosis     103260907   09163 Immune disease    05320 Autoimmune thyroid disease     103260907   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103260907   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103260907  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103260907 Cytokines and neuropeptides [BR:csyr04052]  Cytokines   Interferons    103260907 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  103260907 NCBI-ProteinID:  XP_008056749 UniProt:  A0A1U7T9L4 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MFLPFSLLMALVVLSCQFICSQGCDLPRTHNLGHRRALRLLAQMRRISPFSCLKDRYDFG LPLEEFEGNQFQKAQAISVHHEMIQQTFNLFSTMDSSAAWNETLLDRFCTELYQQLDDLE ACVMQEVKVKETPLMNEDFILAVKKYFQRITLYLKEKKYSPCAWEVVRTEIMKSFSLSTS LQERLRRSE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgttcttgcccttttctttgctgatggccctggtggtgctcagctgccagttcatctgc tctcagggctgtgatctgcctcggacccacaacctgggtcacaggagggccttgaggctc ctggcgcaaatgaggagaatctctcctttctcctgcctgaaggacagatatgactttgga ttgcccctggaggagtttgagggcaaccagttccagaaggctcaagccatctctgtccac catgagatgatccagcagaccttcaacctcttcagcacaatggattcatctgctgcttgg aatgagaccctcctcgacagattctgcactgaactttatcagcagctggatgacctggaa gcctgtgtgatgcaggaggtgaaggtgaaagagactcccttgatgaatgaggacttcatc ctggcggtgaagaaatacttccaaagaatcaccctctacctgaaggagaagaaatacagc ccttgtgcctgggaggttgtcagaacagaaatcatgaaatccttctctttatcaacaagc ttgcaagaaagattaaggaggagcgagtga

DBGET integrated database retrieval system