Carlito syrichta (Philippine tarsier): 103262385 Help Entry 103262385         CDS       T07836                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr03008   Ribosome biogenesis in eukaryotes csyr03013   Nucleocytoplasmic transport csyr03015   mRNA surveillance pathway csyr05014   Amyotrophic lateral sclerosis csyr05164   Influenza A Brite KEGG Orthology (KO) [BR:csyr00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     103262385 (NXT1)    03015 mRNA surveillance pathway     103262385 (NXT1)    03008 Ribosome biogenesis in eukaryotes     103262385 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103262385 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103262385 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:csyr03019]     103262385 (NXT1)    03009 Ribosome biogenesis [BR:csyr03009]     103262385 (NXT1) Messenger RNA biogenesis [BR:csyr03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      103262385 (NXT1) Ribosome biogenesis [BR:csyr03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     103262385 (NXT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 NXF_NTF2 Cofilin_ADF Motif Other DBs NCBI-GeneID:  103262385 NCBI-ProteinID:  XP_008058201 Ensembl:  ENSTSYG00000007592 UniProt:  A0A1U7TX00 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFLLTAQAA PSNTVWKIASDCFRFQDWTS NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcgtctgtggacttcaagacctatgtggaccaggcctgcagggctgccgaggagttt gtcaacgtctactacaccaccatggacaagcggcggcgcctgctgtcccgcctttacatg ggcacagccaccctggtgtggaacggcaatgccgtctcgggacaggaatccttgagtgag ttttttgaaatgctgccttccagtgagttccagatcaatgtggtggactgccagcccgtc catgacgaagccacgccgagccagaccacagtcctcgtcgtgatctgtgggacagtaaag ttcgagggcaataagcaacgggacttcaaccagaacttcctcctgaccgcacaggccgcc cccagcaacaccgtgtggaagattgccagcgactgcttccgcttccaggactggaccagc tag

DBGET integrated database retrieval system