Carlito syrichta (Philippine tarsier): 103263697 Help Entry 103263697         CDS       T07836                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04613   Neutrophil extracellular trap formation csyr05034   Alcoholism csyr05202   Transcriptional misregulation in cancer csyr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103263697  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103263697   09163 Immune disease    05322 Systemic lupus erythematosus     103263697   09165 Substance dependence    05034 Alcoholism     103263697  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csyr03036]     103263697   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103263697 Chromosome and associated proteins [BR:csyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103263697 Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103263697 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF YebU_pre-PUA_dom CENP-S CENP-T_C Motif Other DBs NCBI-GeneID:  103263697 NCBI-ProteinID:  XP_008059561 UniProt:  A0A1U7U0Y8 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MTGTKQITCKSISGKAPRKQLATKATHNSAPSTGGVKKPHHYRPGTVALREIRYFQKSTE LLICKLPFQRLVREIAQNFKTDLRFQSAAIGALQEAIEAYLVGIFDTSLCAIHAKRVTIM PKDIQLARSIRGERA NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgaccggtacaaagcagattacctgcaaatccatcagtggtaaagcacccaggaagcaa ctggctacaaaagccactcacaatagtgcgccctctactggaggggtgaagaaacctcat cattacaggcctggtactgtggctctccgtgaaattagatattttcagaagtccactgaa cttctgatttgcaaacttcctttccagcgtctggtgcgagaaattgctcagaacttcaaa acagatctgcgctttcagagcgcagctattggtgctttacaggaggcaattgaggcctat ctagttggcatttttgacaccagcctgtgtgctatccatgccaaacgtgttacaattatg ccaaaagacatccagctagcacgcagcatacgtggagaacgtgcataa

DBGET integrated database retrieval system