Carlito syrichta (Philippine tarsier): 103263774 Help Entry 103263774         CDS       T07836                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04382   Cornified envelope formation csyr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103263774 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103263774 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103263774 (S100A10) Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of microglial cells    103263774 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  103263774 NCBI-ProteinID:  XP_008059637 Ensembl:  ENSTSYG00000030364 UniProt:  A0A1U7U2W8 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgtttacattccacaaatttgct ggggataaaggctacttaacaaaggaagacctaagagtactcatggaaaaggagttccct gggtttttggaaaatcagaaagaccctctggctgtggacaaaataatgaaggacctggac caatgccgagatggcaaagtgggcttccagagcttcttttcgctcattgctggcctcacc attgcatgcaacgactattttgtagtacacatgaaacagaagggaaagaagtag

DBGET integrated database retrieval system