Carlito syrichta (Philippine tarsier): 103265603 Help Entry 103265603         CDS       T07836                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04066   HIF-1 signaling pathway csyr04120   Ubiquitin mediated proteolysis csyr05170   Human immunodeficiency virus 1 infection csyr05200   Pathways in cancer csyr05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:csyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103265603 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103265603 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103265603 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     103265603 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103265603 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csyr04121]     103265603 (ELOB)    03400 DNA repair and recombination proteins [BR:csyr03400]     103265603 (ELOB) Ubiquitin system [BR:csyr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      103265603 (ELOB)    Cul5 complex      103265603 (ELOB) DNA repair and recombination proteins [BR:csyr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103265603 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  103265603 NCBI-ProteinID:  XP_021570801 UniProt:  A0A3Q0E5G0 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search PDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPE LPDVMKPQDSGSSTNEQAVQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt cccgacgagcagcggctgtacaaggacgaccagctcctggatgatggcaagacgctgggc gagtgtggcttcaccagccaaacagcacggccacaggccccagccacagtggggctggcc ttccgggcagatgacacctttgaggccctgcgcattgagcccttctccagcccacctgag ctgcccgatgtgatgaagccccaggactcaggaagcagcaccaacgaacaagctgtgcag tga

DBGET integrated database retrieval system