Carlito syrichta (Philippine tarsier): 103268363 Help Entry 103268363         CDS       T07836                                  Symbol PFN1 Name (RefSeq) profilin-1 isoform X1   KO K05759   profilin Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04015   Rap1 signaling pathway csyr04810   Regulation of actin cytoskeleton csyr05014   Amyotrophic lateral sclerosis csyr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103268363 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103268363 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103268363 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103268363 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csyr04131]     103268363 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csyr04812]     103268363 (PFN1)    04147 Exosome [BR:csyr04147]     103268363 (PFN1) Membrane trafficking [BR:csyr04131]  Others   Actin-binding proteins    Others     103268363 (PFN1) Cytoskeleton proteins [BR:csyr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103268363 (PFN1) Exosome [BR:csyr04147]  Exosomal proteins   Proteins found in most exosomes    103268363 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103268363 NCBI-ProteinID:  XP_008064116 Ensembl:  ENSTSYG00000033940 UniProt:  A0A1U7UE07 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccggaaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagtttcttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggaatttactatggatcttcgtaccaagagcaccggcggagcccccaccttcaat gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccat ggcggtttgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system