Carlito syrichta (Philippine tarsier): 103271531 Help Entry 103271531         CDS       T07836                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04613   Neutrophil extracellular trap formation csyr05034   Alcoholism csyr05202   Transcriptional misregulation in cancer csyr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103271531  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103271531   09163 Immune disease    05322 Systemic lupus erythematosus     103271531   09165 Substance dependence    05034 Alcoholism     103271531  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csyr03036]     103271531   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103271531 Chromosome and associated proteins [BR:csyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103271531 Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103271531 SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF Motif Other DBs NCBI-GeneID:  103271531 NCBI-ProteinID:  XP_008067193 UniProt:  A0A1U7UER4 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MAHTKQTACKLTGGKAPRKQLATKTALKSAPSTGGVKKPHRYRPGTVALCEIRRYQKSTE LLIRKLPFQGLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEGLLNLCAIHAKRVT IMPKDIQLARRIRGERA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggctcatacaaagcagactgcctgcaaattgactggtggtaaagcacccagaaagcaa ctggctacaaaaaccgctctcaagagtgcaccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactctgtgaaattaggcgttatcagaagtccactgaa cttctgattcgcaaacttcctttccagggtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagcgaggcctat ctggttggcctttttgaaggccttttgaacctgtgtgctatccatgccaaacgtgtaaca attatgccaaaagacatccagctagcacgccgcatacgtggagagcgtgcttaa

DBGET integrated database retrieval system