Carlito syrichta (Philippine tarsier): 103273368 Help Entry 103273368         CDS       T07836                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04060   Cytokine-cytokine receptor interaction csyr04061   Viral protein interaction with cytokine and cytokine receptor csyr04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103273368 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     103273368 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     103273368 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csyr04052]     103273368 (CCL27) Cytokines and neuropeptides [BR:csyr04052]  Cytokines   Chemokines    103273368 (CCL27) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103273368 NCBI-ProteinID:  XP_008068984 Ensembl:  ENSTSYG00000005469 UniProt:  A0A1U7U9P2 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MPRLSSMKGPSTTCSLLVLVLLLSPDPGAALLLPPSTTCCTQLYQKPLTNKLLRKVIRVE LQEANGDCYLQAFVLHLAKRSVCIHPQNRSLARWFEHQGRRLQGTLPNLNLGLLGKMDWS PQQPK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgcccaggctgagcagcatgaaggggccgtcaaccacctgcagcctcctggtgctagtg ttgctcctgagcccagaccctggagcagcactgctattaccacccagcactacctgctgt actcagctctaccaaaagccactcaccaacaagctgctgaggaaggtcatccgggtggaa ctgcaggaggccaatggggactgttacctccaggctttcgtgcttcacctggccaaacgc agtgtctgcattcacccccagaaccgcagcctggctcggtggtttgagcaccaagggaga aggctccaggggactctgcccaacctgaatttggggctgctagggaaaatggactggagc ccccaacagccaaaataa

DBGET integrated database retrieval system