Carlito syrichta (Philippine tarsier): 103274804 Help Entry 103274804         CDS       T07836                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04613   Neutrophil extracellular trap formation csyr05034   Alcoholism csyr05202   Transcriptional misregulation in cancer csyr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csyr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103274804  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103274804   09163 Immune disease    05322 Systemic lupus erythematosus     103274804   09165 Substance dependence    05034 Alcoholism     103274804  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csyr03036]     103274804   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103274804 Chromosome and associated proteins [BR:csyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103274804 Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103274804 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  103274804 NCBI-ProteinID:  XP_008070424 Ensembl:  ENSTSYG00000032308 UniProt:  A0A1U7UDS9 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcacgtacgaagcagacagcgcgcaagtccaccggcgggaaggcgccgcgcaagcag ctggccaccaaggcggcccgcaagagcgccccggccaccggcggcgtgaagaagccccac cgctaccggcccggcaccgtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaaactgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcctgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgctaagcgagtgaccatc atgcccaaggacatccagcttgcccgtcgtatccgtggcgagagggcataa

DBGET integrated database retrieval system