Carlito syrichta (Philippine tarsier): 103275039 Help Entry 103275039         CDS       T07836                                  Symbol CTSB Name (RefSeq) cathepsin B   KO K01363   cathepsin B [EC:3.4.22.1] Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04140   Autophagy - animal csyr04142   Lysosome csyr04210   Apoptosis csyr04612   Antigen processing and presentation csyr04621   NOD-like receptor signaling pathway csyr04924   Renin secretion Brite KEGG Orthology (KO) [BR:csyr00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome     103275039 (CTSB)    04140 Autophagy - animal     103275039 (CTSB)   09143 Cell growth and death    04210 Apoptosis     103275039 (CTSB)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103275039 (CTSB)    04612 Antigen processing and presentation     103275039 (CTSB)   09152 Endocrine system    04924 Renin secretion     103275039 (CTSB)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:csyr01002]     103275039 (CTSB)   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:csyr03110]     103275039 (CTSB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csyr04147]     103275039 (CTSB)    00536 Glycosaminoglycan binding proteins [BR:csyr00536]     103275039 (CTSB) Enzymes [BR:csyr01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.1  cathepsin B      103275039 (CTSB) Peptidases and inhibitors [BR:csyr01002]  Cysteine peptidases   Family C1: papain family    103275039 (CTSB) Chaperones and folding catalysts [BR:csyr03110]  Intramolecular chaperones   Papain family    103275039 (CTSB) Exosome [BR:csyr04147]  Exosomal proteins   Exosomal proteins of microglial cells    103275039 (CTSB) Glycosaminoglycan binding proteins [BR:csyr00536]  Heparan sulfate / Heparin   Others    103275039 (CTSB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C1 Peptidase_C1_2 Motif Other DBs NCBI-GeneID:  103275039 NCBI-ProteinID:  XP_008070643 UniProt:  A0A1U7UPH9 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MLTCCGGLCGDGCNGGYPAEAWSFWTRKGLVSGGLYDSHVGCRPYSIPPCEHHVNGSRPP CTGEGDTPKCSKTCEPGYSPTYKEDKHYGYNSYSVSNMEKEIMAEIYKNGPVEGAFSVYS DFLLYKSGVYQHVTGDMMGGHAIRILGWGVEDGTPYWLVANSWNTDWGDNGFFKILRGQD HCGIESEVVAGIPRTEQYWKKI NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgctcacctgctgcggtggcctgtgcggggacggctgtaatggcggctatcctgccgag gcctggagcttctggacgagaaaaggcctggtttctggtggcctctacgactcccacgtg ggctgcagaccatactccatccctccctgtgagcaccatgtcaacggctcacggcccccg tgcacgggggagggagacacccccaagtgcagcaagacctgcgagcccggctacagcccg acctacaaggaggacaagcactacggatacaattcctacagcgtctccaatatggagaag gagatcatggctgagatctacaaaaacggccccgtggaaggagccttctctgtgtattca gacttcctgctgtacaagtcaggagtgtaccagcacgtcacgggggacatgatgggcggc cacgccatccgcatcctaggctggggggtggaggacggcaccccctactggctggtggcc aattcctggaacaccgactggggtgacaacggcttctttaagatcctcagaggacaggat cactgtggaatcgaatcggaagtggtggctggaattccacgcacggagcagtactggaag aagatctga

DBGET integrated database retrieval system