Carlito syrichta (Philippine tarsier): 103275306 Help Entry 103275306         CDS       T07836                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr04072   Phospholipase D signaling pathway csyr04140   Autophagy - animal csyr04150   mTOR signaling pathway csyr04151   PI3K-Akt signaling pathway csyr04152   AMPK signaling pathway csyr04211   Longevity regulating pathway csyr04218   Cellular senescence csyr04714   Thermogenesis csyr04910   Insulin signaling pathway csyr04919   Thyroid hormone signaling pathway csyr05163   Human cytomegalovirus infection csyr05165   Human papillomavirus infection csyr05168   Herpes simplex virus 1 infection csyr05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     103275306 (RHEB)    04151 PI3K-Akt signaling pathway     103275306 (RHEB)    04152 AMPK signaling pathway     103275306 (RHEB)    04150 mTOR signaling pathway     103275306 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103275306 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     103275306 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103275306 (RHEB)    04919 Thyroid hormone signaling pathway     103275306 (RHEB)   09149 Aging    04211 Longevity regulating pathway     103275306 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     103275306 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     103275306 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     103275306 (RHEB)    05163 Human cytomegalovirus infection     103275306 (RHEB)    05165 Human papillomavirus infection     103275306 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:csyr04031]     103275306 (RHEB) GTP-binding proteins [BR:csyr04031]  Small (monomeric) G-proteins   Ras Family    Rheb     103275306 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  103275306 NCBI-ProteinID:  XP_008070904 UniProt:  A0A1U7UF53 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGDGVSDASSRGWAGAVQSALGENWRRSRLRASFLPNKPRRTPRSPFGGKSSLTIQFVEG QFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTS IKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESS AKENQTAVDVFRRIILEAEKIDGAASQGKSSCSVM NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggagacggagtttccgacgcgtcatcgcgcggatgggcaggggctgtccaatcagcg ctcggggagaactggcgacgttcgcggctgagggcaagtttcctacctaacaagcccagg agaacccccagaagcccctttggagggaaatcttcattgacaattcaatttgttgaaggc caatttgttgactcctacgatccaaccatagaaaacacttttacaaagttgatcacagta aatggacaagaatatcatcttcaacttgtagacacagctgggcaagatgaatattccatc tttcctcagacatactccatagacattaatggttatattcttgtgtattctgttacatca atcaaaagttttgaagtgattaaagttatccatggcaaattgttggatatggtggggaaa gtacagatacctattatgttggttggaaataagaaagacctgcatatggaaagggtgatc agttatgaagaagggaaagctttggcagaatcttggaacgcagcttttttggaatcttct gctaaagaaaatcagactgctgttgatgtctttagaaggataattttggaggcagaaaaa attgatggggcagcttcacaaggaaagtcttcgtgctcggtgatgtaa

DBGET integrated database retrieval system