Carlito syrichta (Philippine tarsier): 110594692 Help Entry 110594692         CDS       T07836                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr03010   Ribosome csyr04120   Ubiquitin mediated proteolysis csyr04137   Mitophagy - animal csyr04140   Autophagy - animal csyr05012   Parkinson disease csyr05022   Pathways of neurodegeneration - multiple diseases csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:csyr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     110594692   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110594692  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110594692    04137 Mitophagy - animal     110594692  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110594692    05167 Kaposi sarcoma-associated herpesvirus infection     110594692   09164 Neurodegenerative disease    05012 Parkinson disease     110594692    05022 Pathways of neurodegeneration - multiple diseases     110594692  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:csyr03011]     110594692    04121 Ubiquitin system [BR:csyr04121]     110594692 Ribosome [BR:csyr03011]  Ribosomal proteins   Eukaryotes    Large subunit     110594692   Archaea     110594692 Ubiquitin system [BR:csyr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    110594692 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_L40e TBK1_ULD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  110594692 NCBI-ProteinID:  XP_021563467 UniProt:  A0A3Q0DM36 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MQIFVKTLTGKTIILEVEPSDTIKNVKVKIQDREGISPNEQHLIFAGKQLEYGYTLSGSN IQRKSTLHLVLRLQGSILKPSLRPHAINCREKKRGHVDNLRPRKQVK NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctcacaggcaagactatcatccttgaggtggagcccagt gacactatcaagaatgtcaaagttaaaatccaagacagggagggcatctcacccaacgag cagcatctgatatttgcaggcaaacagctggaatatggttacactctctcaggttccaac atccagagaaagtccaccctgcacctggtgctgcgcctgcaaggcagcatactcaagcct tccctccgcccccatgccatcaactgccgtgaaaagaagagggggcatgttgacaacctg cgccccaggaagcaagtcaaataa

DBGET integrated database retrieval system