Clostridium tagluense: LL095_20585 Help Entry LL095_20585       CDS       T08715                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ctag  Clostridium tagluense Pathway ctag00020   Citrate cycle (TCA cycle) ctag00720   Other carbon fixation pathways ctag01100   Metabolic pathways ctag01110   Biosynthesis of secondary metabolites ctag01120   Microbial metabolism in diverse environments ctag01200   Carbon metabolism ctag01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ctag00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LL095_20585   09102 Energy metabolism    00720 Other carbon fixation pathways     LL095_20585 Enzymes [BR:ctag01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LL095_20585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_21 LdpA_Fe-S-bd Fer4_9 Fer4_6 Fer4_16 Fer4_8 Fer4_22 Fer4_4 Fer4_3 Fer4_17 Fer4_15 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  WAG50238 LinkDB All DBs Position complement(4491726..4491935) Genome browser AA seq 69 aa AA seqDB search MPRVSFREDRCKGCGLCITACPKKIISFSDRLNIKGYHPATVTEEKMKECIGCASCGKMC PDCVITVEK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgccaagagtaagttttagagaagatagatgtaaaggttgtggactttgtataactgca tgtcctaagaaaattataagtttttcagatagactgaacataaaaggataccatccagct acagttacagaagaaaagatgaaagaatgtattggatgtgcatcttgcggaaaaatgtgc cctgactgcgtaataacagttgaaaagtaa

DBGET integrated database retrieval system