KEGG   Cryptococcus tetragattii: 91987754
Entry
91987754          CDS       T10981                                 
Symbol
I308_100896
Name
(RefSeq) E3 ubiquitin ligase complex SCF subunit sconC
  KO
K03094  S-phase kinase-associated protein 1
Organism
cteg  Cryptococcus tetragattii
Pathway
cteg03083  Polycomb repressive complex
cteg04111  Cell cycle - yeast
cteg04120  Ubiquitin mediated proteolysis
cteg04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cteg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    91987754 (I308_100896)
   04120 Ubiquitin mediated proteolysis
    91987754 (I308_100896)
  09126 Chromosome
   03083 Polycomb repressive complex
    91987754 (I308_100896)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    91987754 (I308_100896)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cteg04131]
    91987754 (I308_100896)
   04121 Ubiquitin system [BR:cteg04121]
    91987754 (I308_100896)
   03036 Chromosome and associated proteins [BR:cteg03036]
    91987754 (I308_100896)
Membrane trafficking [BR:cteg04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    91987754 (I308_100896)
Ubiquitin system [BR:cteg04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     91987754 (I308_100896)
   Cul7 complex
     91987754 (I308_100896)
Chromosome and associated proteins [BR:cteg03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     91987754 (I308_100896)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     91987754 (I308_100896)
SSDB
Motif
Pfam: Skp1 Skp1_POZ BTB
Other DBs
NCBI-GeneID: 91987754
NCBI-ProteinID: XP_066615745
LinkDB
Position
2:91809..92871
AA seq 167 aa
MAEKKQTVILTTSDDEQFTVEKIVAERSAMIKSMMEDLGDQEGQPIPLPNVSSSVLTKIL
EYCDHHKNDPLPTGDANDADDSRRKTSEIGDWDARWIQVDQEMLFEIILAANYLDIKPLL
DVGCKTVANMIKGKTPEEIRKLFNITNDFTPEEEEQIRKENEWAEDR
NT seq 504 nt   +upstreamnt  +downstreamnt
atggccgagaagaagcagactgttatcctcaccacttctgatgatgagcagttcaccgtt
gagaagattgtcgcagaacgatccgccatgatcaaatctatgatggaggatcttggtgac
caagagggccagcccatcccgctccccaacgtctcttcctccgttcttaccaaaatcctc
gagtactgcgaccaccacaagaacgaccctctccccaccggtgatgcgaacgacgccgat
gactctaggaggaagacctctgaaattggtgactgggatgcgcggtggattcaagttgac
caagagatgctttttgagatcatccttgctgccaactacctcgacatcaagcctctcctc
gacgttggttgcaagaccgtcgccaatatgatcaagggtaagactcctgaagaaatccga
aagctcttcaacatcaccaacgacttcactcctgaggaggaagagcagatccgaaaggag
aacgagtgggccgaggaccgttaa

DBGET integrated database retrieval system