Cryptococcus tetragattii: 91988219 Help Entry 91988219          CDS       T10981                                  Symbol I308_101361 Name (RefSeq) hypothetical protein   KO K10740   replication factor A3 Organism cteg  Cryptococcus tetragattii Pathway cteg03030   DNA replication cteg03420   Nucleotide excision repair cteg03430   Mismatch repair cteg03440   Homologous recombination cteg03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cteg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     91988219 (I308_101361)    03420 Nucleotide excision repair     91988219 (I308_101361)    03430 Mismatch repair     91988219 (I308_101361)    03440 Homologous recombination     91988219 (I308_101361)    03460 Fanconi anemia pathway     91988219 (I308_101361)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cteg03032]     91988219 (I308_101361)    03400 DNA repair and recombination proteins [BR:cteg03400]     91988219 (I308_101361) DNA replication proteins [BR:cteg03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     91988219 (I308_101361) DNA repair and recombination proteins [BR:cteg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      91988219 (I308_101361)    MMR (mismatch excision repair)      91988219 (I308_101361)   DSBR (double strand breaks repair)    HR (homologous recombination)      91988219 (I308_101361) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rep_fac-A_3 DUF5818 Motif Other DBs NCBI-GeneID:  91988219 NCBI-ProteinID:  XP_066616203 LinkDB All DBs Position 2:1297343..1297911 Genome browser AA seq 108 aa AA seqDB search MSRLGPEPRINSKHLSEHRGEIVRLIAKVATLSGDTATLETSDGGTVGIHLPRDMHIADQ YVEIIGTVKEDLTIRAHTHIGLGNNLDLRAVNSVIEFSHSPIGQGVLN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgtcttggtcctgagccaagaataaatagcaaacatctttcagaacaccgtgga gagattgttagactcatcgccaaggtagcgaccttgtcaggggatacagcaacccttgag acaagcgatggtggtactgtagggatccatctacctcgagacatgcacattgccgatcaa tatgttgagattatcgggacagtcaaagaagatttgacaatcagggcccatacgcatatc ggtttaggcaataatttagatttgagagcggtcaacagtgtcatagagttttcacattca cctatcggccaaggtgtccttaattag

DBGET integrated database retrieval system