Cryptococcus tetragattii: 91990070 Help Entry 91990070          CDS       T10981                                  Symbol I308_103214 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cteg  Cryptococcus tetragattii Pathway cteg04136   Autophagy - other cteg04138   Autophagy - yeast Brite KEGG Orthology (KO) [BR:cteg00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     91990070 (I308_103214)    04136 Autophagy - other     91990070 (I308_103214)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cteg04131]     91990070 (I308_103214)    04121 Ubiquitin system [BR:cteg04121]     91990070 (I308_103214)    03029 Mitochondrial biogenesis [BR:cteg03029]     91990070 (I308_103214) Membrane trafficking [BR:cteg04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     91990070 (I308_103214) Ubiquitin system [BR:cteg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    91990070 (I308_103214) Mitochondrial biogenesis [BR:cteg03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     91990070 (I308_103214) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Ufm1 Motif Other DBs NCBI-GeneID:  91990070 NCBI-ProteinID:  XP_066614098 LinkDB All DBs Position 5:547101..547869 Genome browser AA seq 108 aa AA seqDB search MATATPALDRLSPAQAQPAETCFVVRFKSIGSAPIMKNNVFKATAGHKFQAVIMFLRQQL GMKKEDSLFTYINAAFAPAPDDTVGNLYKSFGTEGHLIVNYSNTQAWG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggccacagcaacacccgctttggatcgcctttcacctgcccaggcgcaaccagcagaa acttgtttcgtcgtgcgcttcaagtcgattggttcagcgccgatcatgaagaacaatgtc ttcaaagccactgcagggcacaagttccaagcagtcatcatgtttctacggcaacaattg ggtatgaagaaagaagattccttgtttacatatatcaacgctgcctttgcaccagctcct gatgacactgtaggaaacctgtataaatcctttggtacagaaggacacctaatagtaaat tacagtaatactcaggcctggggttga

DBGET integrated database retrieval system