Citrobacter telavivensis: GBC03_03030 Help Entry GBC03_03030       CDS       T07059                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ctel  Citrobacter telavivensis Pathway ctel01100   Metabolic pathways ctel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GBC03_03030    00074 Mycolic acid biosynthesis     GBC03_03030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GBC03_03030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QFS73900 LinkDB All DBs Position 169748..170005 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLDELSTDDIETEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFINAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatcttgaaattaaaaatctcatcataaccacattgaatctggacgaa ctgtcgacagacgacattgaaaccgaggcggcgctgtttggcgacggcctgggactggac tcaattgatgccctggaactgggactggcggtaaaaaatcagtacggcgtggtgctttct gcggaaagcgaagagatgcgtcagcacttcttctccgtcgccacgctggcatcgttcatt aatgcgcaacgtgcctga

DBGET integrated database retrieval system