KEGG   Citrobacter telavivensis: GBC03_10260
Entry
GBC03_10260       CDS       T07059                                 
Symbol
gabP
Name
(GenBank) GABA permease
  KO
K11735  GABA permease
Organism
ctel  Citrobacter telavivensis
Brite
KEGG Orthology (KO) [BR:ctel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctel02000]
    GBC03_10260 (gabP)
Transporters [BR:ctel02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   GBC03_10260 (gabP)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-ProteinID: QFS70566
LinkDB
Position
complement(1697247..1698647)
AA seq 466 aa
MGQLSQSHDLGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAQAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAIILNSW
FPGVPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIALGAAAIGGVYPY
TEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKEVGSYQSVLELLHIPHAKLIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAIMGKINRSKTPYVAVLLSTGAAFLTVVVNYYAPAKVF
KFLIDSSGAIALLVYLVIAISQLRMRKILLAEGGELKLKMWLYPWLTWLVIGFISFVLIV
MLFRPAQQLEVISTGLLGLGIICTVPIMSRWKKLVLWQKAPLQNTR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggggcaactgtcacaatcacatgatttagggggcgggctgaaatcacgccacgtcacc
atgctgtctattgccggggttatcggcgcaagtctgtttgtgggttccagcgtggcgata
gcccaggccggacccgcggtcctgctggcctatctgttcgccgggctactggtggtgatg
atcatgcggatgctggccgaaatggccgtcgccacgccggacaccggttccttttccacc
tacgccgataaagcgatcgggcgatgggcgggctacaccatcggctggttgtactggtgg
ttctgggtgttggtgatcccgcttgaagcgaatatcgccgcaatcatcctcaactcctgg
tttcccggcgtcccgatctggctgttctcgctggttatcacgctggcgttaaccggcagt
aatttgctgagcgtcaaaaactacggtgagtttgagttctggctggcgctgtgcaaagtg
attgccatcctcgcctttatcgccctcggtgcagcggcgatcggcggcgtttacccttac
actgaagtcagcggtatctcgcgcttgtgggatcacggcggctttatgccaaacggtttt
ggtgccgtgctgagcgcgatgcttatcaccatgttttcatttatgggggctgagattgtc
accattgccgccgccgaatccgacacgccggataagcatatcgtccgcgccaccaactcg
gtgatctggcgtatttcaatcttctatctgtgctcgatctttgttgtcgtcgccctgatc
ccgtggaacatgccgggactaaaagaggtcggctcctatcaatcggtgctggaactgctg
catattccgcatgccaaactgatcatggactgtgtgatcctgctgtcggtaaccagctgc
ctgaactccgcgctgtataccgcgtcgcggatgctctactctctgagccgccgtggtgac
gcgccggctattatgggcaaaatcaatcgcagcaaaacgccttacgtggcggtgttgctc
tcgaccggcgcggcatttttaaccgtggtcgtgaactattacgccccggcaaaagtgttt
aagttcctgatcgacagctccggcgccatcgccctgctggtgtatctggtgatcgccatt
tcccagttgcggatgcgcaaaatcctgctggcggaaggcggcgagctcaaactgaaaatg
tggctctatccgtggctgacctggctggtcattggctttatcagttttgtgctgattgtg
atgctctttcgcccggcgcaacagctggaagtcatttccacagggctgctgggactggga
attatttgtaccgtgccgattatgtcgcgctggaaaaaactggtattgtggcaaaaggca
ccgctgcaaaatacccgttaa

DBGET integrated database retrieval system