Citrobacter telavivensis: GBC03_10995 Help Entry GBC03_10995       CDS       T07059                                  Name (GenBank) DinI-like family protein   KO K12149   DNA-damage-inducible protein I Organism ctel  Citrobacter telavivensis Brite KEGG Orthology (KO) [BR:ctel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ctel03400]     GBC03_10995 DNA repair and recombination proteins [BR:ctel03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     GBC03_10995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  QFS70690 LinkDB All DBs Position 1838999..1839232 Genome browser AA seq 77 aa AA seqDB search MKVELTIDRTKELPKGALPALEKELLKRLNYQYEDCSLIIRRAGSDGLSVFGADKDDKKK IEKILQETWESADDWFY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaagttgaattaaccattgatcgcactaaagaacttccaaagggagcgctgcctgca cttgagaaagaactgcttaagcgccttaattatcagtatgaggattgcagtctgataatt cgtcgggctggttctgatggtttgagcgttttcggggctgataaggacgacaaaaagaaa attgagaagatcctccaggaaacctgggaaagtgctgacgactggttttactga

DBGET integrated database retrieval system