Citrobacter telavivensis: GBC03_20305 Help Entry GBC03_20305       CDS       T07059                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ctel  Citrobacter telavivensis Pathway ctel01100   Metabolic pathways ctel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GBC03_20305    00074 Mycolic acid biosynthesis     GBC03_20305   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GBC03_20305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QFS72380 LinkDB All DBs Position complement(3734827..3735087) Genome browser AA seq 86 aa AA seqDB search MLNHEEVMDYTLYCLQGMVESGVDIQPDSDLVNDLGLESIKVMDLLMLLEDKFDISIPIN ILLDVRTPAQLMEALIPYLESINESL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgttaaatcatgaagaagtaatggattacaccctttactgtttgcagggtatggtcgaa agcggtgtggatatccaaccggacagcgatctggttaatgatcttgggctggaatcaatt aaggtcatggatttattaatgttgctggaagataaattcgatatttctatccccattaat atcttgctggatgtcagaacgcctgcgcaattaatggaagcgttaatcccttatctggag agtatcaatgagtctttatga

DBGET integrated database retrieval system