Yamadazyma tenuis: 18247817 Help Entry 18247817          CDS       T03099                                  Symbol PSN45_000556 Name (RefSeq) uncharacterized protein   KO K10881   26 proteasome complex subunit DSS1 Organism cten  Yamadazyma tenuis Pathway cten03050   Proteasome cten03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cten00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     18247817 (PSN45_000556)   09124 Replication and repair    03440 Homologous recombination     18247817 (PSN45_000556)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cten03019]     18247817 (PSN45_000556)    04131 Membrane trafficking [BR:cten04131]     18247817 (PSN45_000556)    03051 Proteasome [BR:cten03051]     18247817 (PSN45_000556)    03400 DNA repair and recombination proteins [BR:cten03400]     18247817 (PSN45_000556) Messenger RNA biogenesis [BR:cten03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      18247817 (PSN45_000556) Membrane trafficking [BR:cten04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     18247817 (PSN45_000556) Proteasome [BR:cten03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      18247817 (PSN45_000556) DNA repair and recombination proteins [BR:cten03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      18247817 (PSN45_000556) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  18247817 NCBI-ProteinID:  XP_006688036 UniProt:  G3B9E5 LinkDB All DBs Position 1:1119346..1119582 Genome browser AA seq 78 aa AA seqDB search MSSKSIENGVPTEDEKKVIKSLEEDDDEFEDFPADTKWTVKQDPQINPDSLWEEDWEDDD NEDDFSAQLKTELEKHRS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagtcaattgaaaacggtgttcctactgaggacgaaaagaaggtgataaag tcgttggaagaggatgatgacgagtttgaagattttccagctgataccaagtggactgtt aaacaggatcctcagatcaacccagacagtttgtgggaagaagactgggaagatgacgat aacgaggacgacttttcggcgcagttgaagacggagttggagaagcacaggagttga

DBGET integrated database retrieval system