Yamadazyma tenuis: 90982117 Help Entry 90982117          CDS       T03099                                  Symbol cdc42, PSN45_003800 Name (RefSeq) GTPase Cdc42   KO K04393   cell division control protein 42 Organism cten  Yamadazyma tenuis Pathway cten04011   MAPK signaling pathway - yeast cten04144   Endocytosis cten05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cten00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     90982117 (cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     90982117 (cdc42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     90982117 (cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cten04131]     90982117 (cdc42)    03036 Chromosome and associated proteins [BR:cten03036]     90982117 (cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cten04147]     90982117 (cdc42)    04031 GTP-binding proteins [BR:cten04031]     90982117 (cdc42) Membrane trafficking [BR:cten04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     90982117 (cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     90982117 (cdc42)   Macropinocytosis    Ras GTPases     90982117 (cdc42) Chromosome and associated proteins [BR:cten03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     90982117 (cdc42) Exosome [BR:cten04147]  Exosomal proteins   Exosomal proteins of microglial cells    90982117 (cdc42)   Exosomal proteins of breast milk    90982117 (cdc42) GTP-binding proteins [BR:cten04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     90982117 (cdc42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  90982117 NCBI-ProteinID:  XP_066014258 LinkDB All DBs Position 5:311283..311867 Genome browser AA seq 194 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTSKFPADYVPTVFDNYAVTVMIGDEPFTLGLFDTAG QEDYDRLRPLSYPSTDVFLVCFSVIAPASFENVKEKWFPEVHHHCPGVPCLIVGTQTDLR NDEVILHRLQKQKLSPITYEMGEKLARELRAVKIVKYVECSALTQRGLKTVFDEAIVAAL EPPVIKKSKKCAIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccataaagtgtgttgttgtcggagatggtgctgtcggaaagacatgtcttttg atctcctacaccacctccaaattccctgccgactacgtgccaaccgtgttcgacaactac gccgtcacggtgatgattggtgacgagcccttcacccttggcttatttgataccgctggt caggaagattatgaccgattgagacctttgagttacccatctaccgacgtgttcttggtg tgcttctcggtgattgcacccgcatcgtttgaaaacgtcaaggaaaagtggttcccagaa gttcatcaccattgtcctggtgttccttgcttaattgtgggaacccaaactgatttgaga aacgacgaggtgattttgcacagattacaaaaacaaaagttgtcgcccatcacctacgaa atgggcgagaagttggccagggagttgcgggccgtcaagattgtcaagtacgttgagtgt tcggcgttaacccaacgaggcttaaagacggtgtttgatgaagctattgtcgctgccttg gaaccccctgtgattaagaagtccaaaaagtgtgccatcttgtaa

DBGET integrated database retrieval system