Comamonas testosteroni TK102: O987_20365 Help Entry O987_20365        CDS       T03218                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ctes  Comamonas testosteroni TK102 Pathway ctes00190   Oxidative phosphorylation ctes01100   Metabolic pathways ctes02020   Two-component system Module ctes_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ctes00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     O987_20365  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     O987_20365 Enzymes [BR:ctes01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      O987_20365 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Asp-B-Hydro_N DUF8147 Motif Other DBs NCBI-ProteinID:  AIJ48166 LinkDB All DBs Position complement(4343099..4343239) Genome browser AA seq 46 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAIWFELMDDEATRRKLLERTNSLPDA NT seq 141 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttctcctggttgctgggtctgccgcttgccgcagcctttgccgtgctcaat gcgatctggtttgagttgatggatgacgaggcaactcgtcgcaagcttctggagcgaacc aattcgctgccggacgcctga

DBGET integrated database retrieval system