Comamonas testosteroni TK102: O987_23425 Help Entry O987_23425        CDS       T03218                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism ctes  Comamonas testosteroni TK102 Brite KEGG Orthology (KO) [BR:ctes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ctes03110]     O987_23425 Chaperones and folding catalysts [BR:ctes03110]  Protein folding catalysts   Protein disulfide isomerase    O987_23425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like GrpE Thioredoxin_2 HrpB4 Motif Other DBs NCBI-ProteinID:  AIJ48767 UniProt:  A0A076PZ93 LinkDB All DBs Position complement(4984361..4984618) Genome browser AA seq 85 aa AA seqDB search MQAVKMYTTAVCPYCIRAKQILQSKGVEQIEEVRIDFDTAAREHMMQTTGRRTVPQIFIG DTHVGGCDDLMALDAKGGLLPLLQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagccgtgaagatgtacaccaccgccgtctgcccctactgcattcgtgccaagcag attctccaatccaagggcgtggagcagatcgaggaggtgcgcatcgacttcgataccgcc gcccgcgagcacatgatgcagaccacgggccgccgcaccgtgccccagatcttcattggc gacacccatgtgggaggttgtgacgatctgatggcgctggatgccaagggcggtctgctg cccctgctgcaaggctga

DBGET integrated database retrieval system