Comamonas terrigena: CT3_34180 Help Entry CT3_34180         CDS       T09012                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ctez  Comamonas terrigena Pathway ctez01100   Metabolic pathways ctez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctez00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CT3_34180 (acpP)    00074 Mycolic acid biosynthesis     CT3_34180 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CT3_34180 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  BBL25963 LinkDB All DBs Position complement(3795781..3796020) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTSEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgctgaacaactcggcgttgaagag tcccaagtgaccagcgaaaaggccttcgtggctgatctgggcgctgactccctggacacg gtcgaactggtgatggccctggaagatgaattcggcatcgaaatccccgatgaagacgct gaaaagatcacgacggtgcaaaacgccatcgactacgccaacacccaccaaaagggctaa

DBGET integrated database retrieval system