Chroococcidiopsis thermalis: Chro_1739 Help Entry Chro_1739         CDS       T02360                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cthe  Chroococcidiopsis thermalis Pathway cthe01100   Metabolic pathways cthe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cthe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Chro_1739    00074 Mycolic acid biosynthesis     Chro_1739   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Chro_1739 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1896 DUF5783 DUF6137 Motif Other DBs NCBI-ProteinID:  AFY87256 UniProt:  K9TYM3 LinkDB All DBs Position 1931693..1931944 Genome browser AA seq 83 aa AA seqDB search MSETEIFEKVKKIVTEQLSVEASKVTPSAHFANDLNADSLDTVELVMALEEEFDIEIPDE AAEQITTVQEAVDYINNKVATSA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaacggaaatttttgaaaaagtaaagaaaatcgtcaccgagcaactaagcgtt gaagccagtaaggtcacgccctcggctcattttgccaacgatctcaatgccgattctctg gacacagtagagctggtaatggctctagaagaagaatttgatattgaaattcctgatgaa gcagccgaacagatcaccacggtacaagaagctgtggactacatcaacaataaagttgct acatccgcgtaa

DBGET integrated database retrieval system