Chroococcidiopsis thermalis: Chro_1949 Help Entry Chro_1949         CDS       T02360                                  Name (GenBank) cytochrome b559, alpha subunit   KO K02707   photosystem II cytochrome b559 subunit alpha Organism cthe  Chroococcidiopsis thermalis Pathway cthe00195   Photosynthesis cthe01100   Metabolic pathways Module cthe_M00161   Photosystem II cthe_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:cthe00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     Chro_1949  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cthe00194]     Chro_1949 Photosynthesis proteins [BR:cthe00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     Chro_1949 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  AFY87459 UniProt:  K9TZN4 LinkDB All DBs Position complement(2182886..2183134) Genome browser AA seq 82 aa AA seqDB search MSGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPNEYYPQER QELPIVSDRFESRKQIEEFIGK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaacgacaggcgagcgtccgttttcggatattattaccagcgtgcgttactgg gtgattcacagtattacgattccagctttgtttatcgctggctggttatttgttagtact ggtcttgcctatgatgtatttggaacaccccgaccaaacgaatactatccccaagaacgg caagagttgccaatcgtgagcgatcgctttgaaagcagaaaacagatcgaggaatttata ggaaagtag

DBGET integrated database retrieval system