Caldimicrobium thiodismutans: THC_0262 Help Entry THC_0262          CDS       T04224                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cthi  Caldimicrobium thiodismutans Pathway cthi01100   Metabolic pathways cthi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cthi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THC_0262    00074 Mycolic acid biosynthesis     THC_0262   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     THC_0262 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAU22661 UniProt:  A0A0U5BVL8 LinkDB All DBs Position 264086..264319 Genome browser AA seq 77 aa AA seqDB search MSVEEKVIDIIAQKLNLSKDQIKPEASFVDDLGADSLDLVELVMAMEEAFGLEVPDEDAE KLRTVKDVLDYVKSRVG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctgttgaggagaaggtgattgatattattgctcaaaagctcaatctctcaaaggat cagattaaaccagaggcctcatttgttgatgacctgggggctgattccttagatttagta gaacttgtcatggctatggaagaggcctttggccttgaagtgcctgacgaagatgccgaa aaattaagaactgttaaggatgtccttgattatgtaaaatccagagtggggtaa

DBGET integrated database retrieval system