Carboxydocella thermautotrophica: CFE_1257 Help Entry CFE_1257          CDS       T05389                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism cthm  Carboxydocella thermautotrophica Pathway cthm00400   Phenylalanine, tyrosine and tryptophan biosynthesis cthm01100   Metabolic pathways cthm01110   Biosynthesis of secondary metabolites cthm01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:cthm00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     CFE_1257 Enzymes [BR:cthm01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      CFE_1257 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 GAAD CdvA VASP_tetra DUF8026 FlaC_arch Motif Other DBs NCBI-ProteinID:  AVX20446 UniProt:  A0A2R4N004 LinkDB All DBs Position 1245955..1246245 Genome browser AA seq 96 aa AA seqDB search MNERRLEELRREIDKVDEAIIELLGRRLKLAREIGLIKGHNRKIRDLRREQRVLERVKLQ ASLQQFSPEVAEKIYRILMDYFVSQQEELLRQQRRP NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatgagcgccgtctggaggaattgcgcagagaaattgataaagtggatgaagctatc attgagttgcttgggcgcagattgaaactggcccgggagattggtctgataaaagggcac aatcgaaaaattcgtgacttgcgccgggagcagcgggtgctggaacgggtcaagttacag gccagcttacagcagttttccccggaagtggcagaaaaaatttatcgcatactgatggac tattttgtcagtcaacaggaagaactgctgcgtcagcagcgacggccttag

DBGET integrated database retrieval system