Thermochaetoides thermophila: CTHT_0037380 Help Entry CTHT_0037380      CDS       T03100                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism cthr  Thermochaetoides thermophila Pathway cthr03050   Proteasome cthr03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cthr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     CTHT_0037380   09124 Replication and repair    03440 Homologous recombination     CTHT_0037380  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cthr03019]     CTHT_0037380    04131 Membrane trafficking [BR:cthr04131]     CTHT_0037380    03051 Proteasome [BR:cthr03051]     CTHT_0037380    03400 DNA repair and recombination proteins [BR:cthr03400]     CTHT_0037380 Messenger RNA biogenesis [BR:cthr03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      CTHT_0037380 Membrane trafficking [BR:cthr04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     CTHT_0037380 Proteasome [BR:cthr03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      CTHT_0037380 DNA repair and recombination proteins [BR:cthr03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      CTHT_0037380 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  18257776 NCBI-ProteinID:  XP_006694162 UniProt:  G0S7X9 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MASSQTAAKKDDKSAADTKQEQTVVEQKPAVLEEDDEFEDFPVDDWPAEETEAANGGGAT QHLWEESWDDDDTTDDFSTQLKEELKKVEAARKR NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcgtcatcacaaactgctgccaagaaggacgacaagtccgccgccgacacgaagcaa gagcagactgttgttgagcagaagccggcagtgctggaggaggacgacgagtttgaggac ttccctgtcgatgactggccggcggaggagacagaagctgccaatggcggcggggcgaca cagcacttgtgggaggagtcgtgggacgacgatgatactactgacgatttctcaacacaa ctcaaggaggagttgaagaaggtcgaagcggcaagaaagcggtaa

DBGET integrated database retrieval system