Thermochaetoides thermophila: CTHT_0061700 Help Entry CTHT_0061700      CDS       T03100                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism cthr  Thermochaetoides thermophila Pathway cthr03060   Protein export cthr04141   Protein processing in endoplasmic reticulum cthr04145   Phagosome Brite KEGG Orthology (KO) [BR:cthr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CTHT_0061700    04141 Protein processing in endoplasmic reticulum     CTHT_0061700  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CTHT_0061700  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cthr04131]     CTHT_0061700   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cthr02044]     CTHT_0061700 Membrane trafficking [BR:cthr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CTHT_0061700 Secretion system [BR:cthr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CTHT_0061700 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Dioxygenase_N Motif Other DBs NCBI-GeneID:  18260208 NCBI-ProteinID:  XP_006696486 UniProt:  G0SFD9 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MADQIQELLDVPREFLKDGIQFINRAQKPDRREFIKISQAVGVGFLIMGAVGYFVKLIHV PLNNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagatccaggagctcctcgacgttccacgcgagttcctcaaggatggtatc cagttcatcaaccgcgctcagaagcctgatcgccgcgagttcatcaagatctcccaggcc gttggtgtcggctttctgatcatgggcgctgttggttactttgtcaagctcatccatgtc cctttgaacaacatcctcgtcggcggcgcgtaa

DBGET integrated database retrieval system