Cupriavidus taiwanensis: RALTA_B2147
Help
Entry
RALTA_B2147 CDS
T00702
Symbol
fliI
Name
(GenBank) FliI: Flagellar Biosynthesis protein; flagellum-specific ATP synthase
KO
K02412
flagellum-specific ATP synthase [EC:
7.4.2.8
]
Organism
cti
Cupriavidus taiwanensis
Pathway
cti02040
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:
cti00001
]
09140 Cellular Processes
09142 Cell motility
02040 Flagellar assembly
RALTA_B2147 (fliI)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
cti02044
]
RALTA_B2147 (fliI)
02035 Bacterial motility proteins [BR:
cti02035
]
RALTA_B2147 (fliI)
Enzymes [BR:
cti01000
]
7. Translocases
7.4 Catalysing the translocation of amino acids and peptides
7.4.2 Linked to the hydrolysis of a nucleoside triphosphate
7.4.2.8 protein-secreting ATPase
RALTA_B2147 (fliI)
Secretion system [BR:
cti02044
]
Type III secretion system
Flagellar export apparatus
RALTA_B2147 (fliI)
Bacterial motility proteins [BR:
cti02035
]
Flagellar system
Flagellar assembly proteins
Type-III secretion
RALTA_B2147 (fliI)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP-synt_ab
T3SS_ATPase_C
ABC_tran
Motif
Other DBs
NCBI-ProteinID:
CAQ72724
UniProt:
B3RCU9
LinkDB
All DBs
Position
2:2324567..2326075
Genome browser
AA seq
502 aa
AA seq
DB search
MAATTRGSRRMPDTAQDTHDAAHAHTQRWIGALNGAAAGIAGLDSKRSCGRLTRAAGLVL
EAVGLRLPVGSDCLIELPAGQFTTDSNAPRTAEAEVVGFGADRLYLMPQSDVVGLLPGAR
VYPLEPSPQPAGISAPREPGSKRLPVGAGLLGRVLDAAGRPLDGLGPLAAAMEVPLAGEQ
INPLMRAPIETVLDTGVRAINGMLTVGRGQRMGLFAGSGVGKSVLLGMMARYTSADVIVV
GLIGERGREVKEFIENILGPEGRRRSVVVAAPADCSPLLRMQGAAYATRLAEYFRDQGQH
VLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPTLVERTGNGPEGGGSITAFY
TVLTEGDDQQDPIADSARAILDGHIVLSRSLAEAGHYPAIDVEASISRAMTALIPHEQFG
SVRRFKQLMSRYQRNRDLISVGAYVPGNDPELDLAIQLHPRMEAFLQQDIHERAGYADAI
AALHSLFDRSEHAQAFTAQHAG
NT seq
1509 nt
NT seq
+upstream
nt +downstream
nt
ttggccgcgacgacccgtgggagccgccgcatgcctgataccgcgcaggacacccacgac
gccgcgcacgcccatacgcaacgctggatcggcgcgctcaacggcgccgcggccggcatt
gccgggctcgacagcaagcgcagctgcggccgcctgacgcgcgccgcggggctggtgctg
gaggccgtcggcctgcgcctgccggtgggcagcgattgcctgatcgagctgcccgccgga
cagttcaccaccgacagcaatgccccgcgcaccgcggaggccgaagtggtcggcttcggc
gccgaccgcctctacctgatgccgcagtccgacgtggtcggcctgctgccgggcgcgcgc
gtctatccgctggagccgtcgccgcaaccggccggcatcagcgctccgcgcgagccgggc
tccaagcgcctgccggtcggcgcgggcctgctggggcgcgtgctggatgcggccggccgc
ccgctggacgggctcggcccgcttgccgcggcaatggaagtcccgctggccggcgagcag
atcaacccgctgatgcgggccccgatcgaaaccgtgctggacaccggcgtgcgcgccatc
aacggcatgctgaccgtcggccgcggccagcgcatgggcctgttcgcgggctcgggcgtg
ggcaagagcgtgctgctgggcatgatggcgcgctacaccagcgccgacgtcatcgtcgtc
ggcctgatcggcgaacgcggccgcgaggtgaaggagttcatcgagaacatcctggggccg
gaaggacgtcgccgctcggtggtggtggccgcgccggcagattgctcgccgttgctgcgc
atgcagggcgccgcctacgcgacgcggctggccgagtatttccgcgaccagggccagcac
gtgctgctgatcatggattcgctgacgcgctacgccatggcccagcgcgaaattgcgctg
gcaatcggcgagccgcccgccaccaagggctatccgccgtcggtcttcgccaagctgccg
acgctggtcgagcgcaccggcaacggccccgagggcggcggctcgatcaccgcgttctac
accgtgctgaccgaaggcgacgaccagcaggaccccatcgccgattccgcgcgcgccatt
ctcgatggccatatcgtgctgtcgcgcagcctggccgaagccggccactatccggccatc
gacgtcgaggcctcgatcagccgcgccatgaccgcgctgatcccgcacgagcagttcggc
tcggtgcgccgcttcaagcagctgatgtcgcgctaccagcgcaaccgcgacctgatcagc
gtgggcgcctacgtgcccggcaacgacccggaactggaccttgcgatccagctgcatccg
cgcatggaagcctttttgcagcaggacatccacgagcgcgccggttacgccgacgccatc
gccgcgctgcacagcctcttcgacaggagtgaacatgctcaagcattcaccgctcaacac
gctggctga
DBGET
integrated database retrieval system